Review



cbd ccbd ll37  (Biosynth Carbosynth)


Bioz Verified Symbol Biosynth Carbosynth is a verified supplier
Bioz Manufacturer Symbol Biosynth Carbosynth manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 92
      Buy from Supplier

    Structured Review

    Biosynth Carbosynth cbd ccbd ll37
    Cbd Ccbd Ll37, supplied by Biosynth Carbosynth, used in various techniques. Bioz Stars score: 92/100, based on 10 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/cbd+ccbd+ll37/LL-37/pm28017866-44-7-18
    Average 92 stars, based on 10 article reviews
    cbd ccbd ll37 - by Bioz Stars, 2026-09
    92/100 stars

    Images

    Related Articles

    Modification:

    Article Title: Collagen tethering of synthetic human antimicrobial peptides cathelicidin LL37 and its effects on antimicrobial activity and cytotoxicity.
    Article Snippet: Synthetic LL37 ([LL-37, 37 aa]) was purchased from Anaspec, Inc. (Fremont, CA) at >95% purity, confirmed by high-performance liquid chromatography (HPLC). .. The modified LL37 peptides with a collagenase-derived CBD (cCBD-LL37) (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT) and fibronectin-derived CBD (fCBD-LL37) (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKCQDSERTFY) were synthesized by New England Peptide, Inc. (Gardner, MA) at >90% purity, also confirmed by HPLC. ..

    Synthesized:

    Article Title: Collagen tethering of synthetic human antimicrobial peptides cathelicidin LL37 and its effects on antimicrobial activity and cytotoxicity.
    Article Snippet: Synthetic LL37 ([LL-37, 37 aa]) was purchased from Anaspec, Inc. (Fremont, CA) at >95% purity, confirmed by high-performance liquid chromatography (HPLC). .. The modified LL37 peptides with a collagenase-derived CBD (cCBD-LL37) (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT) and fibronectin-derived CBD (fCBD-LL37) (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKCQDSERTFY) were synthesized by New England Peptide, Inc. (Gardner, MA) at >90% purity, also confirmed by HPLC. ..

    High Performance Liquid Chromatography:

    Article Title: Collagen tethering of synthetic human antimicrobial peptides cathelicidin LL37 and its effects on antimicrobial activity and cytotoxicity.
    Article Snippet: Synthetic LL37 ([LL-37, 37 aa]) was purchased from Anaspec, Inc. (Fremont, CA) at >95% purity, confirmed by high-performance liquid chromatography (HPLC). .. The modified LL37 peptides with a collagenase-derived CBD (cCBD-LL37) (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKTKKTLRT) and fibronectin-derived CBD (fCBD-LL37) (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESDYKDDDDKCQDSERTFY) were synthesized by New England Peptide, Inc. (Gardner, MA) at >90% purity, also confirmed by HPLC. ..



    Similar Products

    cbd ccbd ll37  (Biosynth Carbosynth)
    92
    Biosynth Carbosynth cbd ccbd ll37
    Cbd Ccbd Ll37, supplied by Biosynth Carbosynth, used in various techniques. Bioz Stars score: 92/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/cbd+ccbd+ll37/LL-37/pm28017866-44-7-18
    Average 92 stars, based on 1 article reviews
    cbd ccbd ll37 - by Bioz Stars, 2026-09
    92/100 stars
    		  Buy from Supplier

    Image Search Results